Sign In | Join Free | My
Search by Category
Wholesale Marketplace
Home > Chemicals > Chemical Projects >

Augment Anabolic Hormone Side Effects

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type


    augment anabolic hormone side effects

    All augment anabolic hormone side effects wholesalers & augment anabolic hormone side effects manufacturers come from members. We doesn't provide augment anabolic hormone side effects products or service, please contact them directly and verify their companies info carefully.

    Total 147 products from augment anabolic hormone side effects Manufactures & Suppliers
    Buy cheap Test Enanthate Powder Legal Injectable Steroids Hormone CAS 315 37 7 For Muscle Gaining from Wholesalers

    Brand Name:LSW

    Model Number:315-37-7

    Place of Origin:China

    ...Injectable Anabolic Steroids Test Enanthate Steroids Hormone for Muscle Gaining CAS:315-37-7 Description: Testosterone Enanthate is one of the oldest and perhaps the most commonly used anabolic steroid of all time. Testosterone...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier


    Buy cheap Healthy Muscle Building Anabolic Steroids , High Pure Muscle Enhancing Steroids from Wholesalers

    Brand Name:Pharmlab

    Model Number:Anabolic Steroids

    Place of Origin:China

    ...An Detailed Article About How Some Anabolic Steroid Use and Abuse Overview Steroids are a general class of agents that all have the ...

    Pharmlab Co.,Ltd
    Verified Supplier


    Buy cheap Anabolic Steroid Oil Raw Testosterone Powder Propionate Test Prop Dosage for Bulking from Wholesalers

    Brand Name:HZ

    Model Number:57-85-2

    Place of Origin:China

    ...Anabolic Steroid Oil Testosterone Propionate Test Prop Dosage for Bulking Specification: Testosterone propionate cycle for cutting ...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier


    Buy cheap 99% Purity Hgh Human Growth Hormone Muscle Building Somatropin IGTROPIN / IGF-1 Lr3 from Wholesalers

    Brand Name:Human Growth Hormone

    Model Number:IGTROPIN / IGF-1 Lr3

    Place of Origin:China

    ...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

    Global chemicals Co.,Ltd
    Verified Supplier

    Buy cheap ​Muscle Building Anabolic Steroid Powder Stanozolol For Bodybulider Supplements , USP BP standard from Wholesalers


    Model Number:10418-03-8

    Place of Origin:China

    ... synthetic anabolic steroid used to progress the muscular development among athletes, it augments red blood cell production, increases bone density and stimulates the appetite. It has low androgenic effects and very high anabolic effect, cannot...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier


    Buy cheap Injectable HGH Hormones Igtropin IGF-1 Long-R3 For Body Building and Weight Loss from Wholesalers

    Place of Origin:China(Mainland)



    99.4% Injectable HGH Igtropin IGF-1 Long-R3 For Body Building & Fat Loss Quick Details: Igtropin Alias : Long-R3 , IGF-1 MF : C20H28O2 MW : 300.44 Purity : 99.4% Appearance : White Powder Grade : Pharmaceutical Grade Storage: Closed, below 2 ~ 8℃ ...

    Wuhan Hezhong Bio-Chemical Manufacture Co., Ltd.
    Verified Supplier


    Buy cheap High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from Wholesalers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier


    Buy cheap White Powder Hgh Human Growth Hormone Igtropin IGF-1 HGh Fragment Cas 12629-01-5 from Wholesalers

    Brand Name:Igtropin

    Model Number:Igtropin

    Place of Origin:china

    ...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

    Linyi dingsheng chemical products Co., Ltd
    Verified Supplier


    Buy cheap Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin from Wholesalers

    Brand Name:HKYC

    Model Number:196078-30-5

    Place of Origin:China

    ...Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin Basic Info. Name: Pramlintide Acetate Cas No.: 196078-30-5 ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Buy cheap White Powder Drostanolone Steroid , Anabolic Steroids Bodybuilding from Wholesalers

    Brand Name:YUANHANG

    Model Number:521-12-0

    Place of Origin:CHINA

    ... a methyl group at the 2nd carbon (carbon alpha) atom. This modification is responsible for the anabolic strength increase. This methyl group

    Yuanhang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier


    Buy cheap Dbol Injectable Anabolic Dianabol 50mg / ml For Bodybuilding Steroids from Wholesalers

    Brand Name:Hong Kong Blue Universal

    Model Number:CAS:72-63-9

    Place of Origin:China

    ...Dbol Injectable Anabolic Dianabol 50mg / ml For Bodybuilding Steroids Dianabol 50 Cook Recipe: (Notes: BB=benzyl benzoate; BA=...

    HongKong Blue Universal Co., Limited.
    Verified Supplier


    Buy cheap Igtropin IGF-1 Lr3 Oral Human Growth Hormone With Amino Acid Absorption from Wholesalers

    Brand Name:SR

    Model Number:94-24-6

    Place of Origin:China

    .../vial,10vials/kit,1mg/vial,10vials/kit Purity 99.9% Product Description: 1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier


    Buy cheap 99% Human Growth Hormone Muscle Building Human Somatropin IGTROPIN / IGF-1 Lr3 from Wholesalers

    Brand Name:Mking

    Model Number:IGTROPIN

    Place of Origin:Hubei, China

    ...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

    Hubei Mking Biotech Co., Ltd.
    Verified Supplier


    Buy cheap Depot Vial Finished Injectable Oil Liquid Anabolic Steroids Winstrol 50mg / Ml Muscle Growth from Wholesalers

    Brand Name:YIHAN

    Model Number:YH-Tren-100

    Place of Origin:China

    ...Depot Vial Finished Injectable Oil Liquid Anabolic Steroids Winstrol 50mg / Ml Muscle Growth Quick Details: Name Winstrol 50ml Other name Stano Zolol, ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier


    Buy cheap Igf-1lr3 Peptides Steroids Customzied Igf-1 LR3 1mg Growth Hormone Peptide For Injection from Wholesalers

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    Follistatin 344 Peptides Steroids Follistatin-315 Fat Burning Peptide For Bodybuildier​ Product information: Product name:IGF-1Lr3 IGF-1Lr3 CAS No.:946870-92-4 IGF-1Lr3 Purity:.98%min IGF-1Lr3 Appearance:White powder IGF-1Lr3 Storage:Dry Cool Place IGF-...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap Weight Loss HGH Human Growth Hormone Injections IGF 1 Long R3 CAS  946870-92-4 from Wholesalers

    Brand Name:Rund

    Model Number:CAS 946870-92-4

    Place of Origin:China

    ...Body Building and Weight Loss Injectable HGH Hormones Igtropin IGF-1 Long-R3/Long R3-IGF-1 CAS 946870-92-4 Details Product name:IGF-1 Long-...

    3M Biotech Co., Ltd
    Verified Supplier

    Buy cheap Pure Raw Hormone Powders Testosterone Propionate 100 For Muscle Enhancement from Wholesalers

    Brand Name:Yuancheng

    Model Number:57-85-2

    Place of Origin:China

    ...: 1. It can be used in the clinical treatment of male sexual dysfunction 2. It has a significant effect on the disease of aplastic anemia 3. It can be used by veterinarians on livestock to...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier


    Buy cheap High Quality Steroid Hormone Testosterone Propionate 80mg/Ml For Mass from Wholesalers

    Brand Name:JNJG

    Place of Origin:China

    ...High Quality Steroid Hormone Testosterone Propionate 80mg/Ml For Mass Basic Info: CAS No 57-85-2 Molecular Formula C22h32o3 ...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Active Member


    Buy cheap HGH Igtropin CAS 946870-92-4 IGF-1 Long-R3 For Body Building & Fat Loss Growth Hormone from Wholesalers

    Brand Name:YIJING

    Model Number:HGH

    Place of Origin:SHANGHAI

    ...HGH Igtropin CAS 946870-92-4 IGF-1 Long-R3 For Body Building & Fat Loss Growth Hormone 99.4% Injectable HGH Igtropin IGF-1 Long-R3 For Body Building & Fat Loss Quick Details: Igtropin ...

    ShangHai ShuCan industrial co.. LTD
    Active Member


    Buy cheap Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1 from Wholesalers

    Brand Name:GB

    Place of Origin:China

    ...Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1 Product name Igtropin Alias Long-R3 , IGF-1 Appearance White Freeze-...

    Hubei God bull Pharmaceutical Co.,Ltd
    Site Member


    Go to Page
    Inquiry Cart 0