Sign In | Join Free | My hfcletter.com
hfcletter.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Chemical Waste >

Augment Anabolic Hormone Side Effects

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    augment anabolic hormone side effects

    All augment anabolic hormone side effects wholesalers & augment anabolic hormone side effects manufacturers come from members. We doesn't provide augment anabolic hormone side effects products or service, please contact them directly and verify their companies info carefully.

    Total 98 products from augment anabolic hormone side effects Manufactures & Suppliers
    Buy cheap Test Enanthate Powder Legal Injectable Steroids Hormone CAS 315 37 7 For Muscle Gaining from Wholesalers

    Brand Name:LSW

    Model Number:315-37-7

    Place of Origin:China

    ...Injectable Anabolic Steroids Test Enanthate Steroids Hormone for Muscle Gaining CAS:315-37-7 Description: Testosterone Enanthate is one of the oldest and perhaps the most commonly used anabolic steroid of all time. Testosterone...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap Healthy Muscle Building Anabolic Steroids , High Pure Muscle Enhancing Steroids from Wholesalers

    Brand Name:Pharmlab

    Model Number:Anabolic Steroids

    Place of Origin:China

    ...An Detailed Article About How Some Anabolic Steroid Use and Abuse Overview Steroids are a general class of agents that all have the ...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap Oil Liquid Injectable Anabolic Steroids Finished Winny 50 Body Fitness from Wholesalers

    Brand Name:Diselbiotech

    Model Number:Pharma grade

    Place of Origin:China

    ...Top Purity Steroid Hormone Finished Liquid Oil Anabolic Stero Injectable Liquid Winny 50 for Body Fitness Product details Product Name Winsstrol-50 Other ...

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Buy cheap Drostanolone Propionate Masteron 150 mg/ml anabolic steroids injection oil liquid from Wholesalers

    Brand Name:Hongkong Saichuang

    Model Number:Injectable anabolic steroids

    Place of Origin:China

    ...Drostanolone Propionate Masteron 150 mg/ml anabolic steroids injection oil liquid for muslce bodybuilding 1. Quick Detail: Injectable Anabolic Steroids Cutting Cycle Steroids Masteron Propionate Drostanolone Propionate 150mg/ml Masteron 150 2. Description:...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap 99% Purity Hgh Human Growth Hormone Muscle Building Somatropin IGTROPIN / IGF-1 Lr3 from Wholesalers

    Brand Name:Human Growth Hormone

    Model Number:IGTROPIN / IGF-1 Lr3

    Place of Origin:China

    ...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

    Global chemicals Co.,Ltd
    Verified Supplier

    Buy cheap High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from Wholesalers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Buy cheap White Powder Hgh Human Growth Hormone Igtropin IGF-1 HGh Fragment Cas 12629-01-5 from Wholesalers

    Brand Name:Igtropin

    Model Number:Igtropin

    Place of Origin:china

    ...1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) ...

    Shandong Chuangrui Chemical Technology Co., Ltd.
    Verified Supplier

    Shandong

    Buy cheap Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin from Wholesalers

    Brand Name:HKYC

    Model Number:196078-30-5

    Place of Origin:China

    ...Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin Basic Info. Name: Pramlintide Acetate Cas No.: 196078-30-5 ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Buy cheap 98% Original  Human Growth Hormone Peptide Weight Loss IGF Des Igf 1lr3 1mg from Wholesalers

    Brand Name:HongKong Blue

    Model Number:946870-92-4

    Place of Origin:CHINA

    ...98% Original Human Growth Hormone Peptide Weight Loss IGF Des Igf 1lr3 1mg Basic Information Product name: IGF-1Lr3 Synonyms: ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Buy cheap White Powder Drostanolone Steroid , Anabolic Steroids Bodybuilding from Wholesalers

    Brand Name:YUANHANG

    Model Number:521-12-0

    Place of Origin:CHINA

    ... a methyl group at the 2nd carbon (carbon alpha) atom. This modification is responsible for the anabolic strength increase. This methyl group

    Yuanhang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Buy cheap Igtropin IGF-1 Lr3 Oral Human Growth Hormone With Amino Acid Absorption from Wholesalers

    Brand Name:SR

    Model Number:94-24-6

    Place of Origin:China

    .../vial,10vials/kit,1mg/vial,10vials/kit Purity 99.9% Product Description: 1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Buy cheap Safest Injectable Anabolic Steroids Powders Primobolan For Muscle Building from Wholesalers

    Brand Name:LANDMARK

    Model Number:HPLC verfied

    Place of Origin:CHINA

    ... Molecular weight of Enanthate ester: 130.1864 Formula: C20H30O2 Melting Point: 138-139 Manufacturer: LandmarkChem Effective dose(oral): (Men)50-100mgs/day; (Women) 10-25mgs/day...

    Landmark Nutraceuticals Co., Limited
    Verified Supplier

    Hongkong

    Buy cheap Depot Vial Finished Injectable Oil Liquid Anabolic Steroids Winstrol 50mg / Ml Muscle Growth from Wholesalers

    Brand Name:YIHAN

    Model Number:YH-Tren-100

    Place of Origin:China

    ...Depot Vial Finished Injectable Oil Liquid Anabolic Steroids Winstrol 50mg / Ml Muscle Growth Quick Details: Name Winstrol 50ml Other name Stano Zolol, ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Buy cheap Igf-1lr3 Peptides Steroids Customzied Igf-1 LR3 1mg Growth Hormone Peptide For Injection from Wholesalers

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    Follistatin 344 Peptides Steroids Follistatin-315 Fat Burning Peptide For Bodybuildier​ Product information: Product name:IGF-1Lr3 IGF-1Lr3 CAS No.:946870-92-4 IGF-1Lr3 Purity:.98%min IGF-1Lr3 Appearance:White powder IGF-1Lr3 Storage:Dry Cool Place IGF-...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap Weight Loss HGH Human Growth Hormone Injections IGF 1 Long R3 CAS  946870-92-4 from Wholesalers

    Brand Name:Rund

    Model Number:CAS 946870-92-4

    Place of Origin:China

    ...Body Building and Weight Loss Injectable HGH Hormones Igtropin IGF-1 Long-R3/Long R3-IGF-1 CAS 946870-92-4 Details Product name:IGF-1 Long-...

    3M Biotech Co., Ltd
    Verified Supplier

    Buy cheap Pure Raw Hormone Powders Testosterone Propionate 100 For Muscle Enhancement from Wholesalers

    Brand Name:Yuancheng

    Model Number:57-85-2

    Place of Origin:China

    ...: 1. It can be used in the clinical treatment of male sexual dysfunction 2. It has a significant effect on the disease of aplastic anemia 3. It can be used by veterinarians on livestock to...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Buy cheap CAS 158861-67-7 Anabolic Injection Steroids Neuromodulators Oxytocin from Wholesalers

    Brand Name:KANGDISEN

    Model Number:2 mg/vial

    Place of Origin:China

    ... Molar Mass: 1007.19 g/mol CAS number: 158861-67-7 PubChem: CID 439302 Oxytocin is a mammalian hormone that acts primarily as a neuromodulator in the brain. Oxytocin is best known for its roles...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Buy cheap Safe Ship Bodybuilding Steroid Hormone Semi-Finished Oil Testosterone Propionate 100mg/Ml for Musclegains from Wholesalers

    Brand Name:Muscle Man

    Model Number:CAS: 57-85-2

    Place of Origin:Hunan,China

    ...Safe Ship Bodybuilding Steroid Hormone Semi-Finished Oil Testosterone Propionate 100mg/Ml for Musclegains Testosterone Propionate Basic Info: CAS No ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Site Member

    Hunan

    Buy cheap Injectable HGH Hormones Igtropin IGF-1 Long-R3 For Body Building and Weight Loss from Wholesalers

    Brand Name:YIJING

    Model Number:HGH

    Place of Origin:SHANGHAI

    ...Injectable HGH Hormones Igtropin IGF-1 Long-R3 For Body Building and Weight Loss Quick Details: Igtropin Alias : Long-...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Buy cheap Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1 from Wholesalers

    Brand Name:GB

    Place of Origin:China

    ...Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1 Product name Igtropin Alias Long-R3 , IGF-1 Appearance White Freeze-...

    Hubei God bull Pharmaceutical Co.,Ltd
    Site Member

    Hubei

    Go to Page
    Inquiry Cart 0